PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G267400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 281aa    MW: 29984.6 Da    PI: 6.1001
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G267400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-182471148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT+eEdell +av++ G g+W+t +r+ g+ R++k+c++rw +yl
  Sobic.003G267400.1.p 24 RGAWTPEEDELLSRAVAKEGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 71
                          89******************************99************97 PP

2Myb_DNA-binding46.86.7e-1578122248
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           g+  ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Sobic.003G267400.1.p  78 GPIAADEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 122
                           566689***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8591971IPR017930Myb domain
SuperFamilySSF466898.44E-2922118IPR009057Homeodomain-like
SMARTSM007177.7E-142373IPR001005SANT/Myb domain
PfamPF002495.6E-162471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-222578IPR009057Homeodomain-like
CDDcd001675.13E-122671No hitNo description
PROSITE profilePS5129425.14872126IPR017930Myb domain
SMARTSM007175.4E-1476124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2579127IPR009057Homeodomain-like
PfamPF002491.9E-1381122IPR001005SANT/Myb domain
CDDcd001671.78E-1182122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MTRKPAAQQR GVGGAGAMRT TLKRGAWTPE EDELLSRAVA KEGEGRWRTL PRRAGLLRCG  60
KSCRLRWMNY LRPDIKRGPI AADEEDLILR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNS  120
HLSKKLIARG IDPRAHTPLP GAAASLHSHS QSHGADAAAA AAGSADKTPA LPEVEPQFAP  180
PPPPPPPPPA HPTLPSGAGV GGDFATSMMG LGAEGFDGFD DPFCAPDVAA RGDFDLGCPI  240
VDDAAFSSFL DSLMDEERIA DYFGDHKDAD DGENDQGGPY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25221265108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082591e-119AK108259.1 Oryza sativa Japonica Group cDNA clone:002-141-A12, full insert sequence.
GenBankD886201e-119D88620.1 Oryza sativa mRNA for OSMYB4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656780.11e-142PREDICTED: transcription repressor MYB5-like
TrEMBLA0A0H4NTH61e-142A0A0H4NTH6_MAIZE; Uncharacterized protein
STRINGGRMZM2G395672_P011e-141(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-67myb domain protein 5